MRPL47

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA037553

 

Antibody HPA047779

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA037553 HPA047779 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

81 57 

Antigen sequence

LKERNMLLTLEQEAKRQRLPMPSPERLDKVVDSMDALDKVVQEREDALRL
LQTGQERARPGAWRRDIFGRIIWHKFKQWVI
 
YNRKRFFALPYVDHFLRLEREKRARIKARKENLERKKAKILLKKFPHLAE
AQKSSLV
 

Matching transcripts

MRPL47-001 - ENSP00000417602 [100%]
MRPL47-002 - ENSP00000259038 [100%]
MRPL47-003 - ENSP00000376427 [94%]
 MRPL47-001 - ENSP00000417602 [100%]
MRPL47-002 - ENSP00000259038 [100%]
MRPL47-003 - ENSP00000376427 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:1500  

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406075)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

29.5, 27.1, 17.0 29.5, 27.1, 17.0 

Antibody dilution

1:250 1:470 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3750 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line CACO-2 shows positivity in mitochondria.
More information
 

Antibody dilution

 1:94 

Validation IF

 Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
MRPL47-001
 
MRPL47-002
 
MRPL47-003