RAB30

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051208

 

Antibody HPA054514

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA051208 HPA054514 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

13 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

47 42 

Antigen sequence

SDNVEKLFLDLACRLISEARQNTLVNNVSSPLPGEGKSISYLTCCNF
 
RSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVG
 

Matching transcripts

RAB30-001 - ENSP00000435189 [100%]
RAB30-003 - ENSP00000260056 [100%]
RAB30-013 - ENSP00000435089 [100%]
RAB30-015 - ENSP00000433832 [100%]
 RAB30-001 - ENSP00000435189 [100%]
RAB30-003 - ENSP00000260056 [100%]
RAB30-004 - ENSP00000433243 [100%]
RAB30-010 - ENSP00000434953 [100%]
RAB30-011 - ENSP00000432193 [100%]
RAB30-012 - ENSP00000437235 [100%]
RAB30-013 - ENSP00000435089 [100%]
RAB30-014 - ENSP00000436587 [100%]
RAB30-015 - ENSP00000433832 [100%]
RAB30-002 - ENSP00000434974 [95%]
RAB30-005 - ENSP00000432336 [83%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
 

Antibody dilution

1:65 1:31 

Validation IF

Supportive: The subcellular location is supported by literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

23.1, 19.2 23.1, 19.2, 19.0, 15.9, 13.9, 13.1, 11.0, 8.8 

Antibody dilution

1:320 1:160 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2600 1:1250 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:125 

Literature conformity

 No avaliable characterization data 

RNA consistency

 Not done 
 

ANTIGEN VIEW

? »
 
 
 « 
 
RAB30-001
 
RAB30-002
 
RAB30-003
 
RAB30-004
 
RAB30-005
 
RAB30-010
 
RAB30-011
 
RAB30-012
 
RAB30-013
 
RAB30-014
 
RAB30-015
 
 »