ANXA7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA064290

 

Antibody CAB004312

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA064290 sc-17815 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

14 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

55  

Antigen sequence

TGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAG
GYPAP
 
 

Matching transcripts

ANXA7-001 - ENSP00000362012 [100%]
ANXA7-002 - ENSP00000362010 [100%]
ANXA7-005 - ENSP00000378317 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human pancreas shows strong cytoplasmic and membranous positivity in islet cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:100 

Literature conformity

 Partly consistent with extensive gene/protein characterization data 

RNA consistency

 Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line PC-3 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:41  

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

52.7, 50.3, 14.0 52.7, 50.3, 14.0 

Antibody dilution

1:140 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:1650  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
ANXA7-001
 
ANXA7-002
 
ANXA7-005