SSB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA012385

 

Antibody HPA017287

 

Antibody CAB004643

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Abnova
 

Product name

HPA012385 HPA017287 H00006741-M01 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 4 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

62 112  

Antigen sequence

VVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEERKQNKVEAKL
RAKQEQEAKQKL
 
AKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTD
FNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVY
IKGFPTDATLDD
 
 

Matching transcripts

SSB-001 - ENSP00000260956 [100%]
SSB-003 - ENSP00000386636 [100%]
 SSB-001 - ENSP00000260956 [100%]
SSB-003 - ENSP00000386636 [100%]
SSB-004 - ENSP00000397029 [100%]
SSB-006 - ENSP00000395758 [90%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebellum shows strong nuclear positivity in purkinje cells.
More information
 Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:35 1:50 1:250 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows no positivity.
More information
 

Antibody dilution

1:15 1:48 1:62 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Testis
More information
 

Target mass (kDa)

46.8 46.8, 21.4, 15.5 46.8, 21.4, 15.5, 13.9 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SSB-001
 
SSB-003
 
SSB-004
 
SSB-006