SPPL2A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036062

 

Antibody HPA067304

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA036062 HPA067304 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

69 33 

Antigen sequence

HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPP
VGIKSKAVVVPWGSCHFLE
 
KFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ
 

Matching transcripts

SPPL2A-001 - ENSP00000261854 [100%]
SPPL2A-003 - ENSP00000453932 [83%]
 SPPL2A-001 - ENSP00000261854 [100%]
SPPL2A-004 - ENSP00000453927 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells of tubules.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:15  

Literature conformity

Consistent with gene/protein characterization data  

RNA consistency

Mainly consistent with RNA expression data  

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line MCF7 shows positivity in vesicles.
More information
 

Antibody dilution

 1:42 

Validation IF

 Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

58.1, 16.5 58.1, 40.0 

Antibody dilution

1:250 1:140 

Validation WB

Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:1700 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SPPL2A-001
 
SPPL2A-003
 
SPPL2A-004