AEBP2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA020893

 

Antibody HPA022282

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA020893 HPA022282 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

63 68 

Antigen sequence

DVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLAD
HIRSIHVDGQRGG
 
LHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQ
KRLKRTLIRKVFNLYLSK
 

Matching transcripts

AEBP2-002 - ENSP00000381840 [100%]
AEBP2-003 - ENSP00000266508 [100%]
AEBP2-004 - ENSP00000354267 [100%]
AEBP2-005 - ENSP00000444255 [100%]
AEBP2-006 - ENSP00000437983 [100%]
 AEBP2-002 - ENSP00000381840 [100%]
AEBP2-004 - ENSP00000354267 [100%]
AEBP2-003 - ENSP00000266508 [81%]
AEBP2-006 - ENSP00000437983 [81%]
AEBP2-007 - ENSP00000381715 [81%]
AEBP2-008 - ENSP00000445587 [81%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows distinct positivity in subsets of leukocytes
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:10 1:35 

Literature conformity

No avaliable characterization data No avaliable characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403504)
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

54.5, 52.8, 34.0, 30.7, 11.9 54.5, 52.8, 34.0, 30.7, 16.2, 15.0 

Antibody dilution

1:125 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:750 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
AEBP2-002
 
AEBP2-003
 
AEBP2-004
 
AEBP2-005
 
AEBP2-006
 
AEBP2-007
 
AEBP2-008