CSAD

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039487

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039487 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

59 

Antigen sequence

FGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLELRSQGESQKQILERC
RAVIRYSVK
 

Matching transcripts

CSAD-001 - ENSP00000436800 [100%]
CSAD-003 - ENSP00000369179 [100%]
CSAD-004 - ENSP00000267085 [100%]
CSAD-005 - ENSP00000401078 [100%]
CSAD-007 - ENSP00000457264 [100%]
CSAD-009 - ENSP00000415314 [100%]
CSAD-017 - ENSP00000415485 [100%]
CSAD-019 - ENSP00000410648 [100%]
CSAD-202 - ENSP00000439419 [100%]
CSAD-011 - ENSP00000455618 [86%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:200 

Literature conformity

No avaliable characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

58.0, 57.6, 55.0, 30.3, 17.9, 16.8, 16.2, 16.0, 14.4 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CSAD-001
 
CSAD-003
 
CSAD-004
 
CSAD-005
 
CSAD-007
 
CSAD-009
 
CSAD-011
 
CSAD-017
 
CSAD-019
 
CSAD-202