ABCC12

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA043100

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA043100 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

91 

Antigen sequence

GPYLISDLDQRGRRRSFAERYDPSLKTMIPVRPCARLAPNPVDDAGLLSF
ATFSWLTPVMVKGYRQRLTVDTLPPLSTYDSSDTNAKRFRV
 

Matching transcripts

ABCC12-001 - ENSP00000311030 [100%]
ABCC12-002 - ENSP00000431232 [100%]
ABCC12-003 - ENSP00000431354 [100%]
ABCC12-004 - ENSP00000433333 [100%]
ABCC12-005 - ENSP00000437047 [100%]
ABCC12-007 - ENSP00000434510 [100%]
ABCC12-008 - ENSP00000435715 [100%]
ABCC12-010 - ENSP00000436647 [100%]
ABCC12-201 - ENSP00000413046 [100%]
ABCC12-202 - ENSP00000401855 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:250 

Literature conformity

Partly consistent with gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

152.3, 113.2, 104.7, 104.6, 70.4, 31.9, 12.0 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
ABCC12-001
 
ABCC12-002
 
ABCC12-003
 
ABCC12-004
 
ABCC12-005
 
ABCC12-007
 
ABCC12-008
 
ABCC12-010
 
ABCC12-201
 
ABCC12-202