SLC14A1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA059570

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA059570 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

42 

Antigen sequence

GHYNPFFPAKLVIPITTAPNISWSDLSALELLKSIPVGVGQI
 

Matching transcripts

SLC14A1-002 - ENSP00000318546 [100%]
SLC14A1-003 - ENSP00000442180 [100%]
SLC14A1-004 - ENSP00000385320 [100%]
SLC14A1-005 - ENSP00000441998 [100%]
SLC14A1-006 - ENSP00000412309 [100%]
SLC14A1-009 - ENSP00000390637 [100%]
SLC14A1-010 - ENSP00000470476 [100%]
SLC14A1-022 - ENSP00000466273 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular and endothelial cells, erythrocytes were distinctly stained.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:125 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

48.3, 42.5, 30.9, 30.6, 28.1, 18.2 

Antibody dilution

1:160 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1950 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SLC14A1-002
 
SLC14A1-003
 
SLC14A1-004
 
SLC14A1-005
 
SLC14A1-006
 
SLC14A1-009
 
SLC14A1-010
 
SLC14A1-022