PSEN2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA038005

 

Antibody CAB013634

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA038005 1685 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Genetic immunization 

Length (aa)

94  

Antigen sequence

FARHCLKFFPAQKPACVDFGASRGRAMLTFMASDSEEEVCDERTSLMSAE
SPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDPDRYVCSGV
 
 

Matching transcripts

PSEN2-002 - ENSP00000355746 [100%]
PSEN2-202 - ENSP00000375745 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human colon shows cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:1700 

Validation IH

 Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:30 1:200 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

53.7 53.7, 50.1, 50.0, 46.5, 40.5, 34.1, 16.2, 14.5, 2.4 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PSEN2-002
 
PSEN2-202