SNCA

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA005459

 

Antibody CAB010877

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SIGMA
 

Product name

HPA005459 S5566 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

94  

Antigen sequence

EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFV
KKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE
 
 

Matching transcripts

SNCA-001 - ENSP00000378437 [100%]
SNCA-002 - ENSP00000378442 [100%]
SNCA-003 - ENSP00000338345 [100%]
SNCA-006 - ENSP00000422238 [100%]
SNCA-008 - ENSP00000426955 [100%]
SNCA-004 - ENSP00000421485 [94%]
SNCA-201 - ENSP00000378440 [94%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows strongly immunoreactive neuropil and weak cytoplasmic positivity in neuronal cells, glial cells.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in cells in granular layer.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:300 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

14.5, 13.1 14.5, 13.1, 11.8, 11.4, 6.9 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:2000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SNCA-001
 
SNCA-002
 
SNCA-003
 
SNCA-004
 
SNCA-006
 
SNCA-008
 
SNCA-201