ANK2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007570

 

Antibody HPA008007

 

Antibody HPA035970

 

Antibody CAB015178

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA007570 HPA008007 HPA035970 sc-28560 

Host species

Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 12 12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

136 136 144  

Antigen sequence

ERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYW
LERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERISHSYAEIEQT
ITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETC
 
ERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYW
LERDGKHATDTNLVECLTKINRMDIVHLMETNTEPLQERISHSYAEIEQT
ITLDHSEGFSVLQEELCTAQHKQKEEQAVSKESETC
 
DGVPKTEGDSSATALFPQTHKEQVQQDFSGKMQDLPEESSLEYQQEYFVT
TPGTETSETQKAMIVPSSPSKTPEEVSTPAEEEKLYLQTPTSSERGGSPI
IQEPEEPSEHREESSPRKTSLVIVESADNQPETCERLDEDAAFE
 
 

Matching transcripts

ANK2-001 - ENSP00000349588 [100%]
ANK2-002 - ENSP00000378044 [100%]
ANK2-004 - ENSP00000421067 [100%]
ANK2-006 - ENSP00000426944 [100%]
ANK2-007 - ENSP00000422853 [100%]
ANK2-008 - ENSP00000421023 [100%]
ANK2-011 - ENSP00000422498 [100%]
ANK2-026 - ENSP00000264366 [100%]
 ANK2-001 - ENSP00000349588 [100%]
ANK2-002 - ENSP00000378044 [100%]
ANK2-004 - ENSP00000421067 [100%]
ANK2-006 - ENSP00000426944 [100%]
ANK2-007 - ENSP00000422853 [100%]
ANK2-008 - ENSP00000421023 [100%]
ANK2-011 - ENSP00000422498 [100%]
ANK2-026 - ENSP00000264366 [100%]
 ANK2-001 - ENSP00000349588 [100%]
ANK2-002 - ENSP00000378044 [100%]
ANK2-004 - ENSP00000421067 [100%]
ANK2-006 - ENSP00000426944 [100%]
ANK2-007 - ENSP00000422853 [100%]
ANK2-008 - ENSP00000421023 [100%]
ANK2-011 - ENSP00000422498 [100%]
ANK2-026 - ENSP00000264366 [100%]
  

Other gene match

    

ANTIBODY VALIDATION

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
  Immunofluorescent staining of human cell line A-549 shows positivity in nucleus but not nucleoli & cytoplasm.
More information
  

Antibody dilution

1:37  1:79  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

    

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

433.7, 430.2, 205.8, 204.8, 117.8, 114.7, 108.6, 63.4 433.7, 430.2, 205.8, 204.8, 117.8, 114.7, 108.6, 63.4 433.7, 430.2, 205.8, 204.8, 117.8, 114.7, 108.6, 63.4 433.7, 430.2, 205.8, 204.8, 189.1, 176.1, 119.9, 117.8, 114.7, 108.6, 63.4, 22.0, 21.8, 19.3, 11.9, 8.9, 6.9 

Antibody dilution

1:250 1:250 1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:500 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunohistochemistry

Image

    

Description

 Immunohistochemical staining of human appendix shows distinct positivity in peripheral nerves.
More information
 Immunohistochemical staining of human colon shows distinct positivity in peripheral nerve.
More information
 Immunohistochemical staining of human colon shows distinct positivity in peripheral nerve.
More information
 

Retrieval method

 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

 1:250 1:800 1:300 

Validation IH

 Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 
 

ANTIGEN VIEW

? »
 
 
 
ANK2-001
 
ANK2-002
 
ANK2-004
 
ANK2-006
 
ANK2-007
 
ANK2-008
 
ANK2-011
 
ANK2-026