CCDC120

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000561

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000561 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

101 

Antigen sequence

QADALRRLHELEEQLRDVRARLGLPVLPLPQPLPLSTGSVITTQGVCLGM
RLAQLSQEDVVLHSESSSLSESGASHDNEEPHGCFSLAERPSPPKAWDQL
R
 

Matching transcripts

CCDC120-001 - ENSP00000365577 [100%]
CCDC120-004 - ENSP00000470294 [100%]
CCDC120-005 - ENSP00000474761 [100%]
CCDC120-006 - ENSP00000474071 [100%]
CCDC120-007 - ENSP00000443351 [100%]
CCDC120-201 - ENSP00000416445 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:10 

Literature conformity

No avaliable characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line MCF7 shows positivity in mitochondria.
More information
 

Antibody dilution

1:45 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1
Lane 2: RT4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

75.0, 70.9, 67.6, 66.4 

Antibody dilution

1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CCDC120-001
 
CCDC120-004
 
CCDC120-005
 
CCDC120-006
 
CCDC120-007
 
CCDC120-201