HMBOX1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA055855

 

Antibody HPA058586

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA055855 HPA058586 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

13 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

83 94 

Antigen sequence

IKRRANIEAAILESHGIDVQSPGGHSNSDDVDGNDYSEQDDSTSHSDHQD
PISLAVEMAAVNHTILALARQGANEIKTEALDD
 
SPSPSNSYDTSPQPCTTNQNGRENNERLSTSNGKMSPTRYHANSMGQRSY
SFEASEEDLDVDDKVEELMRRDSSVIKEEIKAFLANRRISQAVV
 

Matching transcripts

HMBOX1-001 - ENSP00000380516 [100%]
HMBOX1-002 - ENSP00000287701 [100%]
 HMBOX1-001 - ENSP00000380516 [100%]
HMBOX1-002 - ENSP00000287701 [100%]
HMBOX1-003 - ENSP00000452827 [100%]
HMBOX1-004 - ENSP00000430238 [100%]
HMBOX1-005 - ENSP00000430059 [100%]
HMBOX1-006 - ENSP00000430110 [100%]
HMBOX1-014 - ENSP00000453211 [100%]
HMBOX1-015 - ENSP00000453185 [100%]
HMBOX1-017 - ENSP00000475196 [100%]
HMBOX1-201 - ENSP00000384261 [100%]
HMBOX1-202 - ENSP00000401769 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:98  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

47.3 49.9, 47.3, 46.0, 44.5, 43.7, 41.1, 34.6 

Antibody dilution

1:490 1:170 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3950 1:2000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:85 

Literature conformity

 Partly consistent with gene/protein characterization data 

RNA consistency

 Not done 
 

ANTIGEN VIEW

? »
 
 
 « 
 
HMBOX1-001
 
HMBOX1-002
 
HMBOX1-003
 
HMBOX1-004
 
HMBOX1-005
 
HMBOX1-006
 
HMBOX1-014
 
HMBOX1-015
 
HMBOX1-017
 
HMBOX1-201
 
HMBOX1-202
 
 »