CDKN2A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA047838

 

Antibody CAB000093

 

Antibody CAB000445

 

Antibody CAB018232

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Novocastra
 Lab Vision/NeoMarkers
 Santa Cruz Biotechnology
 

Product name

HPA047838 NCL-p16-432 RB-1554 sc-56330 

Host species

Rabbit Mouse Rabbit Mouse 

Clonality

pAb mAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Not known Protein A/G 

Released in version

12 1 1 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Not known Not known 

Length (aa)

68    

Antigen sequence

LVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRL
GQQPLPRRPGHDDGQRPS
 
 
 
 

Matching transcripts

CDKN2A-004 - ENSP00000462950 [100%]
CDKN2A-013 - ENSP00000432664 [100%]
CDKN2A-201 - ENSP00000355153 [100%]
    

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

 Immunohistochemical staining of human stomach shows moderate nuclear and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human lymph node shows moderate nuclear positivity in a subset of cells.
More information
 Immunohistochemical staining of human tonsil shows strong positivity in a subset of cells.
More information
 

Retrieval method

 HIER pH9 HIER pH6 HIER pH6 

Antibody dilution

 1:100 1:200 1:200 

Validation IH

 Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

18.0, 13.9 18.0, 17.9, 16.5, 15.0, 13.9, 12.7, 12.1, 11.2, 11.1 18.0, 17.9, 16.5, 15.0, 13.9, 12.7, 12.1, 11.2, 11.1 18.0, 17.9, 16.5, 15.0, 13.9, 12.7, 12.1, 11.2, 11.1 

Antibody dilution

1:270 1:500 1:500 1:500 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus & nucleoli.
More information
  Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
More information
  

Antibody dilution

1:54  1:50  

Validation IF

Supportive: The subcellular location is supported by literature.  Supportive: The subcellular location is supported by literature.  

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
    

Antibody dilution

1:2150    

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.    
 

ANTIGEN VIEW

? »
 
 
 
CDKN2A-004
 
CDKN2A-013
 
CDKN2A-201