SURF2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044340

 

Antibody HPA052213

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA044340 HPA052213 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

86 68 

Antigen sequence

MSELPGDVRAFLREHPSLRLQTDARKVRCILTGHELPCRLPELQVYTRGK
KYQRLVRASPAFDYAEFEPHIVPSTKNPHQLFCKLT
 
GDGTDDFLTDKEDEKAKPPREKATDESRRETTVYRGLVQKRGKKQLGSLK
KKFKSHHRKPKSFSSCKQ
 

Matching transcripts

SURF2-001 - ENSP00000361032 [100%]
 SURF2-001 - ENSP00000361032 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human oral mucosa shows strong cytoplasmic and nuclear positivity in squamous epithelial cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:150  

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line MCF-7 shows positivity in nucleus & nucleoli.
More information
 Immunofluorescent staining of human cell line MCF-7 shows positivity in nucleus & nucleoli.
More information
 

Antibody dilution

1:114 1:172 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

29.6 29.6 

Antibody dilution

1:250 1:100 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:6850 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SURF2-001