DRD2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015691

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA015691 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

140 

Antigen sequence

LRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLS
STSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHP
KIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQML
 

Matching transcripts

DRD2-001 - ENSP00000354859 [100%]
DRD2-004 - ENSP00000442172 [100%]
DRD2-005 - ENSP00000441068 [100%]
DRD2-010 - ENSP00000438215 [99%]
DRD2-201 - ENSP00000347474 [99%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human hippocampus shows distinct positivity in neuropil and processes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:50 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400274)
More information
 

Target mass (kDa)

50.8, 50.6, 50.5 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
DRD2-001
 
DRD2-004
 
DRD2-005
 
DRD2-010
 
DRD2-201