ATM

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA067142

 

Antibody CAB000102

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Lab Vision/NeoMarkers
 

Product name

HPA067142 MS-1198 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

14 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

76  

Antigen sequence

LTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETELHPTLNADDQECKRNL
SDIDQSFNKVAERVLMRLQEKLKGVE
 
 

Matching transcripts

ATM-003 - ENSP00000388058 [100%]
ATM-201 - ENSP00000278616 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human kidney shows strong nuclear positivity in tubules and glomeruli.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:25 

Literature conformity

 Consistent with extensive gene/protein characterization data 

RNA consistency

 Mainly consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 Application not done for this antibody. 

Antibody dilution

1:114  

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available.  

         GFP

Image

  

Description

Immunofluorescent staining of transgenic HeLa cells show antibody staining in nucleus but excluded from the nucleoli and GFP expression in nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:114  

Validation IFGFP

Supportive: Antibody staining overlaps with GFP tagged protein  

         Western Blot

Image

  

Description

Target too small/large to be analyzed with the present setup Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

350.7 350.7, 157.0, 19.8, 18.1, 17.5, 15.9, 13.3, 11.1 

Antibody dilution

 1:500 

Validation WB

Target too small/large to be analyzed with the present setup Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:4550  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ATM-003
 
ATM-201