CHEK1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044364

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA044364 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

130 

Antigen sequence

KRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLN
PWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVT
SGGVSESPSGFSKHIQSNLDFSPVNSASSE
 

Matching transcripts

CHEK1-001 - ENSP00000391090 [100%]
CHEK1-002 - ENSP00000412504 [100%]
CHEK1-004 - ENSP00000435371 [100%]
CHEK1-005 - ENSP00000442317 [100%]
CHEK1-006 - ENSP00000278916 [100%]
CHEK1-007 - ENSP00000432890 [100%]
CHEK1-201 - ENSP00000388648 [100%]
CHEK1-202 - ENSP00000481616 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line MCF7 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:61 

Validation IF

Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

55.5, 54.4, 50.4, 49.0, 43.7 

Antibody dilution

1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CHEK1-001
 
CHEK1-002
 
CHEK1-004
 
CHEK1-005
 
CHEK1-006
 
CHEK1-007
 
CHEK1-201
 
CHEK1-202