ABCB9

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035114

 

Antibody CAB033052

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA035114 sc-46745 

Host species

Rabbit Goat 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

6 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

71  

Antigen sequence

ESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVHDGSLAPDHLEGRVDFENV
TFTYRTRPHTQVLQNVSFSLS
 
 

Matching transcripts

ABCB9-001 - ENSP00000440288 [100%]
ABCB9-002 - ENSP00000376234 [100%]
ABCB9-004 - ENSP00000280560 [100%]
ABCB9-005 - ENSP00000456375 [100%]
ABCB9-006 - ENSP00000456813 [100%]
ABCB9-016 - ENSP00000440244 [100%]
ABCB9-019 - ENSP00000444834 [100%]
ABCB9-202 - ENSP00000394898 [100%]
ABCB9-201 - ENSP00000280559 [99%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:25 

Literature conformity

Partly consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data Mainly not consistent with RNAseq data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

84.8, 84.5, 79.8, 75.4, 75.3, 28.8, 16.7 84.8, 84.5, 79.8, 77.5, 75.4, 75.3, 30.1, 29.8, 28.8, 25.2, 20.3, 16.7, 16.3, 15.9, 13.0, 7.4 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ABCB9-001
 
ABCB9-002
 
ABCB9-004
 
ABCB9-005
 
ABCB9-006
 
ABCB9-016
 
ABCB9-019
 
ABCB9-201
 
ABCB9-202