CACNA1C

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039796

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039796 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

104 

Antigen sequence

QDETYEVKMNHDTEACSEPSLLSTEMLSYQDDENRQLTLPEEDKRDIRQS
PKRGFLRSASLGRRASFHLECLKRQKDRGGDISQKTVLPLHLVHHQALAV
AGLS
 

Matching transcripts

CACNA1C-001 - ENSP00000382563 [100%]
CACNA1C-002 - ENSP00000382504 [100%]
CACNA1C-003 - ENSP00000382552 [100%]
CACNA1C-004 - ENSP00000382547 [100%]
CACNA1C-005 - ENSP00000382506 [100%]
CACNA1C-006 - ENSP00000382530 [100%]
CACNA1C-007 - ENSP00000382546 [100%]
CACNA1C-008 - ENSP00000382500 [100%]
CACNA1C-010 - ENSP00000382549 [100%]
CACNA1C-011 - ENSP00000382512 [100%]
CACNA1C-012 - ENSP00000382542 [100%]
CACNA1C-013 - ENSP00000382526 [100%]
CACNA1C-015 - ENSP00000336982 [100%]
CACNA1C-017 - ENSP00000266376 [100%]
CACNA1C-019 - ENSP00000382515 [100%]
CACNA1C-020 - ENSP00000382510 [100%]
CACNA1C-021 - ENSP00000341092 [100%]
CACNA1C-022 - ENSP00000382537 [100%]
CACNA1C-023 - ENSP00000329877 [100%]
CACNA1C-024 - ENSP00000382557 [100%]
CACNA1C-031 - ENSP00000385896 [100%]
CACNA1C-032 - ENSP00000385724 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human heart muscle shows distinct membranous positivity in myocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Literature conformity

Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNAseq data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

247.2, 247.1, 245.0, 243.7, 243.6, 243.4, 242.8, 242.4, 241.9, 241.6, 241.5, 240.4, 240.3, 240.2, 239.7, 239.6, 239.5 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
CACNA1C-001
 
CACNA1C-002
 
CACNA1C-003
 
CACNA1C-004
 
CACNA1C-005
 
CACNA1C-006
 
CACNA1C-007
 
CACNA1C-008
 
CACNA1C-010
 
CACNA1C-011
 
CACNA1C-012
 
CACNA1C-013
 
CACNA1C-015
 
CACNA1C-017
 
CACNA1C-019
 
CACNA1C-020
 
CACNA1C-021
 
CACNA1C-022
 
CACNA1C-023
 
CACNA1C-024
 
CACNA1C-031
 
CACNA1C-032
 
 »