CWC27

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA020344

 

Antibody HPA024149

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA020344 HPA024149 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

82 80 

Antigen sequence

REDQTLALLNQFKSKLTQAIAETPENDIPETEVEDDEGWMSHVLQFEDKS
RKVKDASMQDSDTFEIYDPRNPVNKRRREESK
 
EEEVKKLKPKGTKNFSLLSFGEEAEEEEEEVNRVSQSMKGKSKSSHDLLK
DDPHLSSVPVVESEKGDAPDLVDDGEDESA
 

Matching transcripts

CWC27-001 - ENSP00000370460 [100%]
 CWC27-001 - ENSP00000370460 [100%]
CWC27-005 - ENSP00000426802 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.
More information
 Immunohistochemical staining of human esophagus shows moderate nuclear and cytoplasmic positivity in squamous epithelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:60 1:250 

Literature conformity

Not done No avaliable characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:50 1:100 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         siRNA

Image

  

Description

Signal downregulation > 25% by both siRNA:s.
More information
 Application not done for this antibody. 

Antibody dilution

1:60  

Validation siRNA

Supportive: The siRNA validation is supportive.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

53.8 53.8, 43.0 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:15000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CWC27-001
 
CWC27-005