CWC27

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA020344

 

Antibody HPA024149

 

Antibody HPA065809

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA020344 HPA024149 HPA065809 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

82 80 89 

Antigen sequence

REDQTLALLNQFKSKLTQAIAETPENDIPETEVEDDEGWMSHVLQFEDKS
RKVKDASMQDSDTFEIYDPRNPVNKRRREESK
 
EEEVKKLKPKGTKNFSLLSFGEEAEEEEEEVNRVSQSMKGKSKSSHDLLK
DDPHLSSVPVVESEKGDAPDLVDDGEDESA
 
TGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRA
DELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPH
 

Matching transcripts

CWC27-001 - ENSP00000370460 [100%]
 CWC27-001 - ENSP00000370460 [100%]
CWC27-005 - ENSP00000426802 [100%]
 CWC27-001 - ENSP00000370460 [100%]
CWC27-005 - ENSP00000426802 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.
More information
 Immunohistochemical staining of human esophagus shows moderate nuclear and cytoplasmic positivity in squamous epithelial cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6 HIER pH6  

Antibody dilution

1:60 1:250  

Literature conformity

No avaliable gene/protein characterization data No avaliable gene/protein characterization data  

RNA consistency

Not done Not done  

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:50 1:100 1:154 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         siRNA

Image

   

Description

Signal downregulation > 25% by both siRNA:s.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:60   

Validation siRNA

Supportive: The siRNA validation is supportive.   

         Western blot - siRNA

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: siRNA 1
Lane 3: siRNA 2
Lane 4: Scrambled
More information
 Application not done for this antibody. Application not done for this antibody. 

Target mass (kDa)

53.8   

Loading control

Total protein image   

Antibody dilution

1:133   

Validation WB-siRNA

Supportive: Downregulation visible in both siRNA lanes   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

53.8 53.8, 43.0 53.8, 43.0 

Antibody dilution

1:250 1:250 1:510 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:15000 1:6200 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CWC27-001
 
CWC27-005