SCN3A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035396

 

Antibody HPA035397

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA035396 HPA035397 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

48 49 

Antigen sequence

NRRKKRRQREHLEGNNKGERDSFPKSESEDSVKRSSFLFSMDGNRLTS
 
SAAIIQRNFRCYLLKQRLKNISSNYNKEAIKGRIDLPIKQDMIIDKLNG
 

Matching transcripts

SCN3A-001 - ENSP00000283254 [100%]
SCN3A-002 - ENSP00000386726 [100%]
SCN3A-004 - ENSP00000403348 [100%]
SCN3A-201 - ENSP00000353206 [100%]
 SCN3A-001 - ENSP00000283254 [100%]
SCN3A-002 - ENSP00000386726 [100%]
SCN3A-201 - ENSP00000353206 [100%]
SCN3A-202 - ENSP00000439920 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lateral ventricle shows strong cytoplasmic positivity in neurons.
More information
 Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:20 

Literature conformity

Consistent with gene/protein characterization data Partly consistent with gene/protein characterization data 

RNA consistency

Not at all consistent with RNAseq data Not at all consistent with RNAseq data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

226.3, 221.5, 154.5 226.3, 221.5, 54.8 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SCN3A-001
 
SCN3A-002
 
SCN3A-004
 
SCN3A-201
 
SCN3A-202