ASAP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA011136

 

Antibody HPA048565

 

Antibody CAB037292

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SIGMA
 

Product name

HPA011136 HPA048565 A4227 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

14 14 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

93 122  

Antigen sequence

STPRDKQRLSYGAFTNQIFVSTSTDSPTSPTTEAPPLPPRNAGKGNDGGP
SSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQKVALRKT
 
PKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGD
VSPKAQQPSEVTLKSHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPV
PLPRKINTGKNKVRRVKTIYDC
 
 

Matching transcripts

ASAP1-015 - ENSP00000429829 [100%]
 ASAP1-001 - ENSP00000429900 [100%]
ASAP1-004 - ENSP00000429391 [100%]
ASAP1-015 - ENSP00000429829 [100%]
ASAP1-201 - ENSP00000350297 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
More information
 Immunohistochemical staining of human colon shows strong cytoplasmic and membrane positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:35 1:200 1:5000 

Literature conformity

Consistent with gene/protein characterization data Partly consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data Mainly consistent with RNA expression data Mainly not consistent with RNA expression data 

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in centrosome.
More information
 Application not done for this antibody. 

Antibody dilution

 1:58  

Validation IF

 Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available.  

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

52.9 125.5, 124.8, 105.1, 52.9 125.5, 124.8, 105.1, 52.9, 37.1, 11.2, 4.0 

Antibody dilution

1:250 1:290 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:2350  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ASAP1-001
 
ASAP1-004
 
ASAP1-015
 
ASAP1-201