CC2D1B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027500

 

Antibody HPA031426

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA027500 HPA031426 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

98 94 

Antigen sequence

LESQLASVRRGRKINEDEIPPPVALGKRPLAPQEPANRSPETDPPAPPAL
ESDNPSQPETSLPGISAQPVSDLDPDPRALLSSRQREYKVAALSAKRA
 
RIGKRFGAVLEALEKGQPVDLSAMPPAPEDLKPQQASQAPTAPSVIPPAV
ERVQPVMAPDVPATPVAPTESQTVLDALQQRLNKYREAGIQARS
 

Matching transcripts

CC2D1B-001 - ENSP00000360642 [100%]
CC2D1B-003 - ENSP00000284376 [100%]
CC2D1B-002 - ENSP00000395921 [88%]
 CC2D1B-001 - ENSP00000360642 [100%]
CC2D1B-002 - ENSP00000395921 [100%]
CC2D1B-003 - ENSP00000284376 [100%]
CC2D1B-004 - ENSP00000402440 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in glial cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:25  

Literature conformity

No avaliable characterization data  

RNA consistency

Not done  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

94.2, 93.6, 69.5 94.2, 93.6, 74.5, 69.5 

Antibody dilution

1:250 1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:72 

Validation IF

 Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
CC2D1B-001
 
CC2D1B-002
 
CC2D1B-003
 
CC2D1B-004