OBSCN

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019497

 

Antibody HPA021186

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA019497 HPA021186 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

104 143 

Antigen sequence

RVDLTSTDYDTAADATESSSYFSAQGYLSSREQEGTESTTDEGQLPQVVE
ELRDLQVAPGTRLAKFQLKVKGYPAPRLYWFKDGQPLTASAHIRMTDKKI
LHTL
 
ACVVVSGSESEAESSSGGELDDAFRRAARRLHRLFRTKSPAEVSDEELFL
SADEGPAEPEEPADWQTYREDEHFICIRFEALTEARQAVTRFQEMFATLG
IGVEIKLVEQGPRRVEMCISKETPAPVVPPEPLPSLLTSDAAP
 

Matching transcripts

OBSCN-001 - ENSP00000284548 [100%]
OBSCN-011 - ENSP00000455507 [100%]
OBSCN-202 - ENSP00000355668 [100%]
OBSCN-203 - ENSP00000355670 [100%]
OBSCN-204 - ENSP00000409493 [100%]
 OBSCN-001 - ENSP00000284548 [100%]
OBSCN-011 - ENSP00000455507 [100%]
OBSCN-202 - ENSP00000355668 [100%]
OBSCN-203 - ENSP00000355670 [100%]
OBSCN-204 - ENSP00000409493 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
More information
 Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:250 1:3500 

Literature conformity

Partly consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane, cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:100 1:667 

Validation IF

Non-supportive: The subcellular location is not consistent with literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Target too small/large to be analyzed with the present setup Target too small/large to be analyzed with the present setup 

Target mass (kDa)

973.0, 868.5, 721.5, 611.0, 407.6 973.0, 868.5, 721.5, 611.0, 407.6 

Antibody dilution

  

Validation WB

Target too small/large to be analyzed with the present setup Target too small/large to be analyzed with the present setup 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
OBSCN-001
 
OBSCN-011
 
OBSCN-202
 
OBSCN-203
 
OBSCN-204