ADAMTS5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA005661

 

Antibody HPA030906

 

Antibody HPA030908

 

Antibody CAB025996

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 R&D Systems
 

Product name

HPA005661 HPA030906 HPA030908 MAB2198 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

3 14 14 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

116 77 78  

Antigen sequence

KGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGT
SAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLR
GPWAEEEKGRVYGDGS
 
KSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTVQCQ
DGNRKLAKGCPLSQRPSAFKQCLLKKC
 
SHDDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGH
GNCLLDLPRKQILGPEELPGQTYDATQQ
 
 

Matching transcripts

ADAMTS5-001 - ENSP00000284987 [100%]
 ADAMTS5-001 - ENSP00000284987 [100%]
 ADAMTS5-001 - ENSP00000284987 [100%]
  

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human lateral ventricle shows strong cytoplasmic positivity in glial cells.
More information
 Application not done for this antibody. Application not done for this antibody. Immunohistochemical staining of human fallopian tube shows strong positivity in cytoplasm and cilia of glandular cells.
More information
 

Retrieval method

HIER pH6   HIER pH6 

Antibody dilution

1:25   1:80 

Literature conformity

Partly consistent with extensive gene/protein characterization data   Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly not consistent with RNA expression data   Mainly not consistent with RNA expression data 

         Immunofluorescence

Image

    

Description

Application not done for this antibody. Immunofluorescent staining of human cell line RH-30 shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line RH-30 shows positivity in nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

 1:27 1:21  

Validation IF

 Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available.  

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

101.7 101.7 101.7 101.7 

Antibody dilution

1:250 1:250 1:250 1:500 

Validation WB

Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected Uncertain: No bands detected 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500 1:3000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ADAMTS5-001