AK9

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030804

 

Antibody HPA030805

 

Antibody HPA031779

 

Antibody HPA031781

 

Antibody HPA036324

 

Antibody HPA036711

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA030804 HPA030805 HPA031779 HPA031781 HPA036324 HPA036711 

Host species

Rabbit Rabbit Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 12 6 12 12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

82 88 91 103 68 86 

Antigen sequence

VMAEHNPQYLIELNGNKPAEELFMIVMDRLKYLNLKRAAILTKLQGAEEE
INDTMENDELFRTLASYKLIAPRYRWQRSKWG
 
VVTMIEETIKMSQDINFEQPYEKHAEILQEVLGEVMEENKDRFPGAPKYG
GWIVDNCPIVKELWMALIKKGIIPDLVIYLSDTENNGK
 
YCPVTYKDGNQRYEALVPGSINYALEYHNRIYICENKEKLQKFLRSPLKY
WEQKLPHKLPPLREPILLTSLPLPGYLEQGIATSLIKAMNA
 
CIDKLCITPQELLSRLGEFEQFCPVSLAESQELFDCSATDSLEFAAEFRG
HYYKMSSQEKLNKFLENPELYVPPLAPHPLPSADMIPKRLTLSELKSRFP
KCA
 
SEWWLKEPIRSTGFILDGFPRYPEEAQFLGDRGFFPDAAVFIQVDDQDIF
DRLLPAQIEKWKLKQKKK
 
ERKRHLGDTKHFCPVVLKENFILQPGNTEEAAKYREKIYYFSSAEAKEKF
LEHPEDYVAHEEPLKAPPLRICLVGPQGSGKTMCGR
 

Matching transcripts

AK9-006 - ENSP00000357944 [100%]
AK9-007 - ENSP00000285397 [100%]
AK9-202 - ENSP00000410186 [100%]
 AK9-006 - ENSP00000357944 [100%]
AK9-202 - ENSP00000410186 [100%]
 AK9-003 - ENSP00000418771 [100%]
AK9-004 - ENSP00000419758 [100%]
AK9-202 - ENSP00000410186 [100%]
 AK9-003 - ENSP00000418771 [100%]
AK9-202 - ENSP00000410186 [100%]
AK9-004 - ENSP00000419758 [90%]
 AK9-001 - ENSP00000347431 [100%]
AK9-002 - ENSP00000418670 [100%]
AK9-201 - ENSP00000344637 [100%]
AK9-202 - ENSP00000410186 [100%]
 AK9-001 - ENSP00000347431 [100%]
AK9-201 - ENSP00000344637 [100%]
AK9-202 - ENSP00000410186 [100%]
 

Other gene match

      

ANTIBODY VALIDATION

         Immunohistochemistry

Image

      

Description

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.
More information
 Immunohistochemical staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.
More information
 Immunohistochemical staining of human stomach, upper shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:100 1:600 1:150 1:250 1:100 1:80 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Immunofluorescence

Image

      

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nuclear membrane & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli & nuclear membrane.
More information
  Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:38 1:185  1:147 1:122 1:8 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  Uncertain: The subcellular location is partly supported by literature or no literature is available. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

      

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

221.4, 84.9, 48.5 221.4, 84.9 221.4, 87.2, 36.4 221.4, 87.2, 36.4 221.4, 42.0, 39.0, 25.3 221.4, 42.0, 39.0 

Antibody dilution

1:250 1:250 1:250 1:250 1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

      

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:3000 1:3000 1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
AK9-001
 
AK9-002
 
AK9-003
 
AK9-004
 
AK9-006
 
AK9-007
 
AK9-201
 
AK9-202