ATP6V1C1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA023943

 

Antibody HPA024243

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA023943 HPA024243 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

62 81 

Antigen sequence

NFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQ
EYYPYVYYKIDC
 
VVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDD
FRHKARENKFIVRDFQYNEEEMKADKEEMNR
 

Matching transcripts

ATP6V1C1-001 - ENSP00000379203 [100%]
ATP6V1C1-002 - ENSP00000428204 [100%]
ATP6V1C1-003 - ENSP00000430129 [100%]
ATP6V1C1-004 - ENSP00000430282 [100%]
 ATP6V1C1-001 - ENSP00000379203 [100%]
ATP6V1C1-002 - ENSP00000428204 [100%]
ATP6V1C1-003 - ENSP00000430129 [100%]
ATP6V1C1-004 - ENSP00000430282 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in parietal cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:200  

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419795)
More information
 

Target mass (kDa)

43.9, 35.7 43.9, 35.7 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane.
More information
 

Antibody dilution

 1:50 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
ATP6V1C1-001
 
ATP6V1C1-002
 
ATP6V1C1-003
 
ATP6V1C1-004