AFF2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003139

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA003139 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

141 

Antigen sequence

SSTSDSNTDQEETLQIKVLPPCIISGGNTAKSKEICGASLTLSTLMSSSG
SNNNLSISNEEPTFSPIPVMQTEILSPLRDHENLKNLWVKIDLDLLSRVP
GHSSLHAAPAKPDHKETATKPKRQTAVTAVEKPAPKGKRKH
 

Matching transcripts

AFF2-001 - ENSP00000359489 [100%]
AFF2-003 - ENSP00000345459 [100%]
AFF2-201 - ENSP00000286437 [100%]
AFF2-202 - ENSP00000359486 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:15 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

144.8, 141.1, 140.9, 105.1 

Antibody dilution

1:250 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
AFF2-001
 
AFF2-003
 
AFF2-201
 
AFF2-202