SFXN2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA018150

 

Antibody HPA026834

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA018150 HPA026834 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

97 35 

Antigen sequence

MEADLSGFNIDAPRWDQRTFLGRVKHFLNITDPRTVFVSERELDWAKVMV
EKSRMGVVPPGTQVEQLLYAKKLYDSAFHPDTGEKMNVIGRMSFQLP
 
PMMRQQELIKGICVKDRNENEIGHSRRAAAIGITQ
 

Matching transcripts

SFXN2-001 - ENSP00000358909 [100%]
SFXN2-002 - ENSP00000473325 [100%]
SFXN2-005 - ENSP00000473504 [100%]
SFXN2-007 - ENSP00000473578 [100%]
SFXN2-008 - ENSP00000473518 [100%]
SFXN2-010 - ENSP00000473573 [100%]
SFXN2-012 - ENSP00000473316 [100%]
SFXN2-013 - ENSP00000473374 [100%]
 SFXN2-001 - ENSP00000358909 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubules.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:200 1:100 

Literature conformity

Partly consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403612)
More information
 

Target mass (kDa)

36.2, 21.3, 19.0, 17.4, 15.9, 15.7, 12.9 36.2 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
More information
 

Antibody dilution

 1:50 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
SFXN2-001
 
SFXN2-002
 
SFXN2-005
 
SFXN2-007
 
SFXN2-008
 
SFXN2-010
 
SFXN2-012
 
SFXN2-013