DYRK1A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015323

 

Antibody HPA015810

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA015323 HPA015810 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

116 68 

Antigen sequence

VRQQFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHHHHGNSSH
HHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTS
LSSSTTSSSTSSSSTG
 
HTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNISDQ
QVSALSYSDQIQQPLTNQ
 

Matching transcripts

DYRK1A-003 - ENSP00000340373 [100%]
DYRK1A-006 - ENSP00000381932 [100%]
DYRK1A-203 - ENSP00000407854 [100%]
 DYRK1A-001 - ENSP00000342690 [100%]
DYRK1A-003 - ENSP00000340373 [100%]
DYRK1A-005 - ENSP00000412269 [100%]
DYRK1A-006 - ENSP00000381932 [100%]
DYRK1A-008 - ENSP00000381929 [100%]
DYRK1A-201 - ENSP00000319032 [100%]
DYRK1A-202 - ENSP00000416089 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human fallopian tube shows cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:7 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251MG shows positivity in cytoplasm.
More information
 

Antibody dilution

1:40 1:21 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Non-supportive: The subcellular location is not consistent with literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

85.6, 84.6, 59.0 85.6, 84.6, 66.1, 61.9, 60.3, 14.9 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
DYRK1A-001
 
DYRK1A-003
 
DYRK1A-005
 
DYRK1A-006
 
DYRK1A-008
 
DYRK1A-201
 
DYRK1A-202
 
DYRK1A-203