C2CD2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030922

 

Antibody HPA030924

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA030922 HPA030924 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

83 75 

Antigen sequence

SPRKKSTIIISGISKTSLSQDHDAALMQGYTASVDSTHQEDAPSHPERAA
ASAPPEEAESAQASLAPKPQEDELDSWDLEKEP
 
AKSKELHLQISEAGRSSEGLLATATVPLDLFKKQPSGPQSFTLTSGSACG
SSVLGSVTAEFSYMEPGELKSWPIP
 

Matching transcripts

C2CD2-001 - ENSP00000369853 [100%]
C2CD2-002 - ENSP00000329302 [100%]
C2CD2-006 - ENSP00000388704 [88%]
 C2CD2-001 - ENSP00000369853 [100%]
C2CD2-002 - ENSP00000329302 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human adrenal gland shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:300 1:10 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

75.5, 58.6, 19.8 75.5, 58.6 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

 1:9 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
C2CD2-001
 
C2CD2-002
 
C2CD2-006