ABHD3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA010729

 

Antibody HPA052862

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA010729 HPA052862 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

146 146 

Antigen sequence

KKPQLVTGGESFSRFLQDHCPVVTETYYPTVWCWEGRGQTLLRPFITSKP
PVQYRNELIKTADGGQISLDWFDNDNSTCYMDASTRPTILLLPGLTGTSK
ESYILHMIHLSEELGYRCVVFNNRGVAGENLLTPRTYCCANTEDLE
 
MLLLNYLGKIGSKTPLMAAATFSVGWNTFACSESLEKPLNWLLFNYYLTT
CLQSSVNKHRHMFVKQVDMDHVMKAKSIREFDKRFTSVMFGYQTIDDYYT
DASPSPRLKSVGIPVLCLNSVDDVFSPSHAIPIETAKQNPNVALVL
 

Matching transcripts

ABHD3-001 - ENSP00000289119 [100%]
ABHD3-003 - ENSP00000462935 [82%]
 ABHD3-001 - ENSP00000289119 [100%]
ABHD3-002 - ENSP00000462578 [100%]
ABHD3-003 - ENSP00000462935 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lung shows strong cytoplasmic positivity in a subset of alveolar cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:125  

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & vesicles.
More information
 Immunofluorescent staining of human cell line PC-3 shows positivity in nucleoli.
More information
 

Antibody dilution

1:19 1:42 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

46.0, 40.4 46.0, 40.4, 24.4 

Antibody dilution

1:250 1:210 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:1700 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ABHD3-001
 
ABHD3-002
 
ABHD3-003