ALAS2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001638

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA001638 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

149 

Antigen sequence

GNYVFSYDQFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAQHFSEASVAS
KDVSVWCSNDYLGMSRHPQVLQATQETLQRHGAGAGGTRNISGTSKFHVE
LEQELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHAS
 

Matching transcripts

ALAS2-006 - ENSP00000332369 [100%]
ALAS2-007 - ENSP00000379501 [100%]
ALAS2-008 - ENSP00000337131 [100%]
ALAS2-004 - ENSP00000407204 [89%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:25 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT-4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

64.6, 63.5, 60.6, 24.8 

Antibody dilution

1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ALAS2-004
 
ALAS2-006
 
ALAS2-007
 
ALAS2-008