RNF166

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA042970

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA042970 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

93 

Antigen sequence

PCRGCNKKVTLAKMRVHISSCLKVQEQMANCPKFVPVVPTSQPIPSNIPN
RSTFACPYCGARNLDQQELVKHCVESHRSDPNRVVCPICSAMP
 

Matching transcripts

RNF166-001 - ENSP00000326095 [100%]
RNF166-002 - ENSP00000440454 [86%]
RNF166-007 - ENSP00000446301 [86%]
RNF166-009 - ENSP00000457374 [86%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:600 

Literature conformity

No avaliable characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane, cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:200 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY405857)
More information
 

Target mass (kDa)

26.1, 18.2, 14.4 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:12000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
RNF166-001
 
RNF166-002
 
RNF166-007
 
RNF166-009