USF1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036233

 

Antibody HPA036535

 

Antibody CAB001480

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA036233 HPA036535 sc-8983 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

13 13 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

58 72  

Antigen sequence

ELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHGLE
VVIKNDSN
 
IQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTEGTGAISGYP
ATQSMTQAVIQGAFTSDDAVDT
 
 

Matching transcripts

USF1-001 - ENSP00000357000 [100%]
USF1-002 - ENSP00000356999 [100%]
USF1-003 - ENSP00000356998 [100%]
USF1-201 - ENSP00000390109 [100%]
 USF1-001 - ENSP00000357000 [100%]
USF1-002 - ENSP00000356999 [100%]
USF1-003 - ENSP00000356998 [100%]
USF1-011 - ENSP00000435005 [88%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
More information
 Application not done for this antibody. Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:25  1:250 

Literature conformity

Consistent with extensive gene/protein characterization data  Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNAseq data  Consistent with RNAseq data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line MCF7 shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line MCF7 shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:35 1:38 1:62 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

33.5, 31.0, 27.4 33.5, 31.0, 24.1 33.5, 31.0, 27.4, 24.1, 18.4, 10.7, 4.9 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
USF1-001
 
USF1-002
 
USF1-003
 
USF1-011
 
USF1-201