C1R

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001551

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA001551 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

127 

Antigen sequence

PNNFETTTVITVPTGYRVKLVFQQFDLEPSEGCFYDYVKISADKKSLGRF
CGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDFSNEENGTIMFYKGFLAYY
QAVDLDECASRSKSGEEDPQPQCQHLC
 

Matching transcripts

C1R-001 - ENSP00000438682 [100%]
C1R-003 - ENSP00000444271 [100%]
C1R-201 - ENSP00000438615 [100%]
C1R-008 - ENSP00000442946 [91%]
C1R-006 - ENSP00000446356 [82%]
C1R-010 - ENSP00000445285 [80%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human bone marrow shows cytoplasmic positivity in bone marrow poietic cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:150 

Literature conformity

Not done 

RNA consistency

Mainly not consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:45 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400654)
More information
 

Target mass (kDa)

73.7, 41.3, 39.6, 17.9, 17.6, 16.2 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
C1R-001
 
C1R-003
 
C1R-006
 
C1R-008
 
C1R-010
 
C1R-201