ACE

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029298

 

Antibody CAB002426

 

Antibody CAB002921

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Novocastra
 Chemicon
 

Product name

HPA029298 NCL-CD143-510 MAB3500 

Host species

Rabbit Mouse Mouse 

Clonality

pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Not known 

Released in version

9 1 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Not known 

Length (aa)

138   

Antigen sequence

KFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKY
GTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETT
YSVATVCHPNGSCLQLEPDLTNVMATSRKYEDLLWAWE
 
 
 

Matching transcripts

ACE-001 - ENSP00000290866 [100%]
ACE-007 - ENSP00000290863 [100%]
ACE-009 - ENSP00000392247 [100%]
ACE-202 - ENSP00000397593 [100%]
ACE-203 - ENSP00000464539 [100%]
ACE-006 - ENSP00000462599 [86%]
   

Other gene match

ACE - ENSG00000264813 [100%]
   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
More information
 Immunohistochemical staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:70 1:100 1:500 

Literature conformity

No avaliable characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407289)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

149.7, 131.7, 84.0, 83.3, 78.7, 23.1 149.7, 131.7, 84.0, 83.3, 78.7, 58.5, 53.8, 35.5, 33.0, 23.1, 18.1, 15.7, 15.4, 13.0, 12.4, 4.5, 3.9 149.7, 131.7, 84.0, 83.3, 78.7, 58.5, 53.8, 35.5, 33.0, 23.1, 18.1, 15.7, 15.4, 13.0, 12.4, 4.5, 3.9 

Antibody dilution

1:125 1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).   
 

ANTIGEN VIEW

? »
 
 
 
ACE-001
 
ACE-006
 
ACE-007
 
ACE-009
 
ACE-202
 
ACE-203