GNE

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007045

 

Antibody HPA027258

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA007045 HPA027258 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

133 141 

Antigen sequence

DDFDINTRLHTIVRGEDEAAMVESVGLALVKLPDVLNRLKPDIMIVHGDR
FDALALATSAALMNIRILHIEGGEVSGTIDDSIRHAITKLAHYHVCCTRS
AEQHLISMCEDHDRILLAGCPSYDKLLSAKNKD
 
VPFDQFIQLVAHAGCMIGNSSCGVREVGAFGTPVINLGTRQIGRETGENV
LHVRDADTQDKILQALHLQFGKQYPCSKIYGDGNAVPRILKFLKSIDLQE
PLQKKFCFPPVKENISQDIDHILETLSALAVDLGGTNLRVA
 

Matching transcripts

GNE-001 - ENSP00000367134 [100%]
GNE-002 - ENSP00000445117 [100%]
GNE-003 - ENSP00000379839 [100%]
GNE-004 - ENSP00000437765 [100%]
GNE-005 - ENSP00000414760 [100%]
GNE-201 - ENSP00000439155 [100%]
 GNE-001 - ENSP00000367134 [100%]
GNE-002 - ENSP00000445117 [100%]
GNE-003 - ENSP00000379839 [100%]
GNE-004 - ENSP00000437765 [100%]
GNE-005 - ENSP00000414760 [100%]
GNE-201 - ENSP00000439155 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
More information
 Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:250 1:50 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & mitochondria.
More information
 

Antibody dilution

1:35 1:50 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

83.1, 79.3, 78.6, 71.3, 66.8 83.1, 79.3, 78.6, 71.3, 66.8 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
GNE-001
 
GNE-002
 
GNE-003
 
GNE-004
 
GNE-005
 
GNE-201