CBS

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001223

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA001223 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

155 

Antigen sequence

GGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYR
CIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEI
PNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGI
GAPHR
 

Matching transcripts

CBS-001 - ENSP00000344460 [97%]
CBS-002 - ENSP00000352643 [97%]
CBS-003 - ENSP00000381231 [97%]
CBS-004 - ENSP00000381225 [97%]
CBS-201 - ENSP00000381234 [97%]
CBS-202 - ENSP00000439332 [97%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

61.9, 60.6, 51.2 

Antibody dilution

1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CBS-001
 
CBS-002
 
CBS-003
 
CBS-004
 
CBS-201
 
CBS-202