CCDC12

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA056814

 

Antibody HPA060530

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA056814 HPA060530 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

81 72 

Antigen sequence

EALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYV
PEDEDLKKRRVPQAKPVAVEEKVKEQLEAAK
 
KPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERL
KGQEDSLASAVDAATEQKTCDS
 

Matching transcripts

CCDC12-001 - ENSP00000416263 [100%]
CCDC12-201 - ENSP00000292314 [100%]
CCDC12-006 - ENSP00000387490 [94%]
CCDC12-011 - ENSP00000473887 [84%]
 CCDC12-001 - ENSP00000416263 [100%]
CCDC12-201 - ENSP00000292314 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach, lower shows strong nuclear positivity in glandular cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:150  

Literature conformity

No avaliable gene/protein characterization data  

RNA consistency

Not done  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line MCF7 shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:127 1:200 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

20.5, 19.2, 10.5, 9.6 20.5, 19.2 

Antibody dilution

1:420 1:710 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:5050 1:8500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CCDC12-001
 
CCDC12-006
 
CCDC12-011
 
CCDC12-201