LRRC14

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA021047

 

Antibody HPA063512

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA021047 HPA063512 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

129 73 

Antigen sequence

LLPRELFPLLFKVAFMDKKTVVLRELVHTWPFPLLSFQQLLQECAHCSRA
LLQERPSTESMQAVILGLTARLHTSEPGASTQPLCRKHALRVLDMTGLLD
DGVEQDPGTMSMWDCTAAVARTCIAQQQG
 
VDLRVNRASYAFLREALRSSVGSPLRLCCRDLRAEDLPMRNTVALLQLLD
AGCLRRVDLRFNNLGLRGLSVII
 

Matching transcripts

LRRC14-001 - ENSP00000292524 [100%]
LRRC14-002 - ENSP00000434768 [100%]
LRRC14-003 - ENSP00000436452 [100%]
LRRC14-005 - ENSP00000434738 [100%]
 LRRC14-001 - ENSP00000292524 [100%]
LRRC14-002 - ENSP00000434768 [100%]
LRRC14-003 - ENSP00000436452 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity tubular cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:75  

Literature conformity

Not done  

RNA consistency

Mainly not consistent with RNAseq data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in actin filaments, focal adhesion sites & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:100 1:52 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415049)
More information
  

Target mass (kDa)

54.5, 33.5, 17.6 54.5, 33.5 

Antibody dilution

1:250 1:170 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:2050 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
LRRC14-001
 
LRRC14-002
 
LRRC14-003
 
LRRC14-005