SAP30BP

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA042382

 

Antibody HPA052943

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA042382 HPA052943 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

110 84 

Antigen sequence

SEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTT
TASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGS
KTTVISAVGT
 
QELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMD
MNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYP
 

Matching transcripts

SAP30BP-001 - ENSP00000462116 [100%]
SAP30BP-002 - ENSP00000347592 [100%]
SAP30BP-015 - ENSP00000463758 [100%]
 SAP30BP-001 - ENSP00000462116 [100%]
SAP30BP-002 - ENSP00000347592 [100%]
SAP30BP-005 - ENSP00000293208 [100%]
SAP30BP-008 - ENSP00000463545 [100%]
SAP30BP-015 - ENSP00000463758 [100%]
SAP30BP-026 - ENSP00000463615 [85%]
SAP30BP-027 - ENSP00000462133 [85%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line MCF7 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:85 1:57 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415705)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415705)
More information
 

Target mass (kDa)

35.8, 33.9, 32.1 35.8, 33.9, 32.1, 27.6, 26.3, 13.0, 11.0 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:2300 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human kidney shows strong nuclear / nuclear membranous positivity in cells in tubules along with strong nuclear positivity in cells in glomeruli.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:225 

Literature conformity

 Consistent with gene/protein characterization data 

RNA consistency

 Consistent with RNAseq data 
 

ANTIGEN VIEW

? »
 
 
 
SAP30BP-001
 
SAP30BP-002
 
SAP30BP-005
 
SAP30BP-008
 
SAP30BP-015
 
SAP30BP-026
 
SAP30BP-027