TPCN2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA016561

 

Antibody HPA027080

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA016561 HPA027080 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

58 121 

Antigen sequence

ENFLHKWDPRSHLQPLAGTPEATYQMTVELLFRDILEEPGEDELTERLSQ
HPHLWLCR
 
QFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQNLL
QVLQKVQLDSSHRQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPP
RPEYQSPFLQSAQFLFGHYYF
 

Matching transcripts

TPCN2-001 - ENSP00000294309 [100%]
TPCN2-003 - ENSP00000445551 [98%]
 TPCN2-001 - ENSP00000294309 [99%]
TPCN2-003 - ENSP00000445551 [99%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli.
More information
  

Antibody dilution

1:118  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

85.2, 64.6 85.2, 64.6 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human prostate shows strong membranous positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:150 

Validation IH

 Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 
 

ANTIGEN VIEW

? »
 
 
 
TPCN2-001
 
TPCN2-003