ALPL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007105

 

Antibody HPA008765

 

Antibody CAB020829

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA007105 HPA008765 3292.00.02 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

3 3 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Genetic immunization 

Length (aa)

130 119  

Antigen sequence

LTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAIL
YGNGPGYKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSK
GPMAHLLHGVHEQNYVPHVMAYAACIGANL
 
SQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRL
DGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDPHNVDYLLGLFEPGDMQY
ELNRNNVTDPSLSEMVVVA
 
 

Matching transcripts

ALPL-001 - ENSP00000363973 [100%]
ALPL-002 - ENSP00000363965 [100%]
ALPL-003 - ENSP00000363962 [100%]
ALPL-004 - ENSP00000363963 [100%]
ALPL-201 - ENSP00000394765 [100%]
ALPL-202 - ENSP00000437674 [100%]
ALPL-203 - ENSP00000442672 [100%]
 ALPL-001 - ENSP00000363973 [100%]
ALPL-002 - ENSP00000363965 [100%]
ALPL-201 - ENSP00000394765 [100%]
ALPL-202 - ENSP00000437674 [100%]
ALPL-203 - ENSP00000442672 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human adrenal gland shows strong cytoplasmic and membranous positivity in cortical cells.
More information
 Immunohistochemical staining of human adrenal gland shows strong cytoplasmic and membranous positivity in cortical cells.
More information
 Immunohistochemical staining of human adrenal gland shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:10 1:350 1:250 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows no positivity.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
 

Antibody dilution

1:15 1:83 1:62 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
   

Target mass (kDa)

57.3, 51.0, 48.9, 17.8 57.3, 51.0, 48.9 57.3, 51.0, 48.9, 17.8 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ALPL-001
 
ALPL-002
 
ALPL-003
 
ALPL-004
 
ALPL-201
 
ALPL-202
 
ALPL-203