CAPN13

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029497

 

Antibody HPA030034

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA029497 HPA030034 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

92 63 

Antigen sequence

DIDATQLQGLLNQELLTGPPGDMFSLDECRSLVALMELKVNGRLDQEEFA
RLWKRLVHYQHVFQKVQTSPGVLLSSDLWKAIENTDFLRGIF
 
ISRELLHLVTLRYSDSVGRVSFPSLVCFLMRLEAMAKTFRNLSKDGKGLY
LTEMEWMSLVMYN
 

Matching transcripts

CAPN13-001 - ENSP00000295055 [100%]
CAPN13-201 - ENSP00000431298 [100%]
 CAPN13-001 - ENSP00000295055 [100%]
CAPN13-201 - ENSP00000431298 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human breast shows strong cytoplasmic positivity in granular pattern in glandular cells.
More information
 Immunohistochemical staining of human bronchus shows moderate cytoplasmic and membranous positivity in respiratory epithelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:200 1:40 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

76.8, 76.7 76.8, 76.7 

Antibody dilution

1:250 1:250 

Validation WB

Uncertain: No bands detected Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:12000 1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CAPN13-001
 
CAPN13-201