RPRD2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045778

 

Antibody HPA061693

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA045778 HPA061693 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

88 96 

Antigen sequence

KSQTSTNPKAALKSKIVAEFRSQALIEELLLYKRSEDQIELKEKQLSTMR
VDVCSTETLKCLKDKTGGKKFSKEFEEASSKLEEFVNG
 
PEESPVPSPSMDAPSPTGSESPFQGMGGEESQSPTMESEKSATPEPVTDN
RDVEDMELSDVEDDGSKIIVEDRKEKPAEKSAVSTSVPTKPTENIS
 

Matching transcripts

RPRD2-002 - ENSP00000358064 [100%]
RPRD2-001 - ENSP00000383785 [97%]
RPRD2-201 - ENSP00000445482 [97%]
 RPRD2-001 - ENSP00000383785 [100%]
RPRD2-002 - ENSP00000358064 [100%]
RPRD2-201 - ENSP00000445482 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:1500  

Literature conformity

No avaliable characterization data  

RNA consistency

Not done  

         Western Blot

Image

  

Description

  

Target mass (kDa)

156.0, 152.9, 100.3 156.0, 152.9, 100.3 

Antibody dilution

1:660 1:90 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:5250 1:1000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line SiHa shows positivity in vesicles & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:28 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
RPRD2-001
 
RPRD2-002
 
RPRD2-201