BAP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA028814

 

Antibody HPA055560

 

Antibody CAB004322

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA028814 HPA055560 sc-28383 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

6 12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

81 95  

Antigen sequence

EPYHDIRFNLMAVVPDRRIKYEARLHVLKVNRQTVLEALQQLIRVTQPEL
IQTHKSQESQLPEESKSASNKSPLVLEANRA
 
PVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLS
PLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMV
 
 

Matching transcripts

BAP1-001 - ENSP00000417132 [100%]
 BAP1-001 - ENSP00000417132 [100%]
BAP1-010 - ENSP00000296288 [100%]
BAP1-014 - ENSP00000420647 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human pancreas shows distinct nucleolar positivity in exocrine cells.
More information
  Immunohistochemical staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:25  1:100 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Immunofluorescence

Image

   

Description

 Immunofluorescent staining of human cell line HeLa shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:55 1:25 

Validation IF

 Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401476)
More information
  Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

80.4  80.4, 78.2, 28.2, 14.6, 12.3, 4.6 

Antibody dilution

1:250  1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present  Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500 1:2200  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
BAP1-001
 
BAP1-010
 
BAP1-014