ETNPPL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044546

 

Antibody HPA072938

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA044546 HPA072938 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

74 81 

Antigen sequence

VLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKTESVTSENTPCKTK
MLKEAHIELLRDSTTDSKENPSRK
 
LAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDIRGIGLFIGID
LVKDHLKRTPATAEAQHIIYKMKEKRVLLSA
 

Matching transcripts

ETNPPL-001 - ENSP00000423240 [100%]
ETNPPL-002 - ENSP00000296486 [100%]
ETNPPL-003 - ENSP00000392269 [100%]
ETNPPL-004 - ENSP00000427065 [100%]
 ETNPPL-001 - ENSP00000423240 [100%]
ETNPPL-002 - ENSP00000296486 [100%]
ETNPPL-003 - ENSP00000392269 [100%]
ETNPPL-004 - ENSP00000427065 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in glial cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:500  

Literature conformity

No avaliable gene/protein characterization data  

RNA consistency

Mainly not consistent with RNA expression data  

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus.
More information
 

Antibody dilution

 1:39 

Validation IF

 Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410615)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

55.7, 55.0, 51.0, 48.9 55.7, 55.0, 51.0, 48.9 

Antibody dilution

1:250 1:90 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:12000 1:1550 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ETNPPL-001
 
ETNPPL-002
 
ETNPPL-003
 
ETNPPL-004