ETNPPL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044546

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA044546 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

74 

Antigen sequence

VLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKTESVTSENTPCKTK
MLKEAHIELLRDSTTDSKENPSRK
 

Matching transcripts

ETNPPL-001 - ENSP00000423240 [100%]
ETNPPL-002 - ENSP00000296486 [100%]
ETNPPL-003 - ENSP00000392269 [100%]
ETNPPL-004 - ENSP00000427065 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human stomach shows distinct nuclear and cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:500 

Literature conformity

No avaliable characterization data 

RNA consistency

Mainly not consistent with RNAseq data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410615)
More information
 

Target mass (kDa)

55.7, 55.0, 51.0, 48.9 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:12000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
ETNPPL-001
 
ETNPPL-002
 
ETNPPL-003
 
ETNPPL-004